Att välja ett saltvattensakvariefiltreringssystem

Att välja ett filtreringssystem för din tank kan verka som en skrämmande uppgift. Det finns så många olika typer av filter (vått / torrt, Berlin-metoden, Jaulbert-metoden, kapseln, UGF, vätska, proteinskimmer, etc.) att välja mellan, det kan vara svårt. Lyckligtvis finns det en ganska enkel metod för att välja rätt filtersystem för din tank.

Grunderna i filter

Innan du kan bestämma vilka filtertyper du vill använda måste du förstå vilken funktion varje filter utför. Med undantag av det biologiska filtret är inget annat enda filter ett absolut krav. Låt oss ta en snabb titt på de olika filtren.

  • Biologiska filter
  • Kapselfilter
  • Protein Skimmers
  • Under grusfilter

Nu när du förstår grunderna för varje filtertyp, låt oss börja sätta ihop ditt filtreringssystem. Följande process eliminerar alternativ som inte fungerar för din situation, en efter en tills dina alternativ är reducerade till bara några få typer. Klicka på länken nedan för att komma igång.

Sump eller ingen sump?

Lär dig vad en sump är, för- och nackdelar med att använda en sump och de olika stilarna av sumps. Det finns också information för dig som gör-det-själv som gillar att göra sin egen utrustning när det är möjligt.

Pros

  • Erbjuder en plattform för det bredaste utbudet av utrustning

  • Ökar systemets vattenvolym



  • Kan fungera som ett refugium för alger, levande stenar eller mangrover

  • Kan hålla all utrustning utom synhåll

Nackdelar

  • Kan vara svårt att plumma

  • Kan vara bullrig

  • Ökad risk för externa vattenläckor

Nu kommer vi till den första gaffeln i vägen när vi väljer ett filter. Du väljer antingen ett filter med en sump eller ett utan sump.

Utrustning i sump

Saltvattensakvarium som inkluderar en sump kan hysa det största utbudet av utrustning. Modeller för allt från pumpar, till våta / torra filter, till proteinspridare, till värmare, till alger, levande berg och denitratorer som har utformats specifikt för sumpar kan hittas.

Om du har en grundläggande uppfattning om vilka filtertyper du använder i din sump kan du få en känsla för hur mycket varje filter kommer att kosta och vilka modeller som fungerar för dig genom att läsa recensioner läsa recensioner och jämföra priser på in-sump protein skimmers, en egen egen våt / torrfilter, nedsänkbara värmare och nedsänkbara pumpar (powerheads). Många akvarister inkluderar också levande berg, några av de gynnsamma makroalgerna eller till och med mangroveplantor i deras sumpar.

Det är inte svårt att ställa in proteinskimmeren i din sump - det tar bara lite planering.

Extern plats?

En del utrustning (pumpar, skummare, kapselfilter, UV-filter) kan placeras utanför tanken, anslutas till tanken med olika slangar, rör eller överflöden.

Pros

  • Fler utrustningsalternativ

  • Du behöver inte använda Hang On eller In Tank-utrustning

  • Renare snygg tank

Nackdelar

  • Kan göra området nära tanken rörigt

  • Ökar möjligheten till externa vattenläckor

Nästa gaffel på vägen: Är externt placerad utrustning en möjlighet eller önskvärd för din situation?

Fjärrmonterad utrustning

Om du inte vill ha en sump och du vill hålla din tank (inifrån och ut) så fräsch som möjligt, kan fjärrmonterad utrustning vara biljetten för dig. Det finns ett antal utrustningsdelar som kan monteras på avstånd från din tank. Många av artiklarna nedan är specifikt designade för eller kan anpassas till fjärrmontering.

Många i-Sump Protein Skimmers kan enkelt anpassas.
De flesta kapselfilter är utformade för att anpassas enkelt för fjärrmontering.
Många av de kombinerade våta / torra systemen kan också anpassas.

Var försiktig när du väljer och ställer in komponenterna. Vissa av dem kräver att de hålls på samma nivå som tanken.

Häng på eller i tanken?

Det finns ett brett utbud av utrustning som kan hängas utanför baksidan och sidorna av ett akvarium. Proteinskummare, vattenpumpar, våta / torra filter och utrustning med överflöde finns i en mängd olika stilar, tillverkade av ett antal tillverkare.

De typer av utrustning som kan monteras eller användas inuti tanken är något begränsad. Det finns emellertid ett antal filtreringssystem som är utformade för att endast använda utrustning och material i tanken. Många SW akvarium purister använder mycket få enheter och har några av de mest fantastiska akvarier du någonsin kommer att se.

Här är nästa gaffel i vägen: Hang-On-Tank-utrustning vs In-Tank-utrustning.

Häng-på-tank-utrustning

Många akvarister föredrar bekvämligheten med Hang-On-Tank-utrustning. Om du har rummet (vanligtvis mindre än 8 ') på antingen baksidan eller sidorna av ditt akvarium, kommer du att hitta detta en fantastisk plats att hänga på alla dina nya tankleksaker. Nästan alla typer av saltvattenakvarieutrustning finns i Hang-On-Tank-stil. Följande länkar ger dig en uppfattning om vilken Hang-On-Tank-utrustning som finns på marknaden och hur mycket priserna varierar.

  • Protein skimmers
  • Våta / torra filter
  • Kapselfilter
  • refugiums
  • Pumps

Du kan enkelt blanda och matcha olika delar för att slutföra din filtreringssystemdesign.

Utrustning i tanken

Att bara förlita sig på In-Tank-utrustning begränsar dina alternativ för filtreringsutrustning något. Som sagt, några av de mest framstående FO-, FOWLR- och Reef-systemen använder bara det som kan placeras i tanken för filtrering.

denära Gravel Filters är den gamla standby och fungerar ganska bra. De kräver lite mer underhåll än några av de andra biologiska filtren, men de är billiga (du kan enkelt anpassa din egen UGF) och är lätt att installera. Kontroversen om undergravelfilter kommer troligen att rasa i flera år, men du kan läsa argumenten och fatta ditt eget beslut om det kommer att fungera för dig eller inte.

Live Rock / Berlin Systems och Live Sand Filtration & Jaubert eller Plenum System-inställningarna har funnits länge och är bland de favoriter som används av revsystemets purister.

Det finns ett antal In-Tank-Skimmers som tar lite plats i din tank och fungerar ganska bra.

För vattencirkulation i din tank ger det stora utbudet av nedsänkbara pumpar på marknaden idag dig många alternativ att välja mellan.

Lägg till en sänkbar värmare (tillval) och en luftpump (om det behövs) så är du redo att gå.